vodafone kein ipv6

vodafone kein ipv6

} "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, } "initiatorBinding" : true, "initiatorBinding" : true, }, } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "displaySubject" : "true", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "kudoEntity", "displaySubject" : "true", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "ProductAnswerComment", ] "context" : "", } }, ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", } "selector" : "#messageview_5", { ] } ] ] "disableKudosForAnonUser" : "false", ] "action" : "rerender" "parameters" : { } "action" : "rerender" { }, "actions" : [ } "action" : "rerender" } var resetMenu = function() { { "action" : "rerender" { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:feedbackData", { { "actions" : [ "context" : "", } else { } "eventActions" : [ { "event" : "kudoEntity", { ] "action" : "pulsate" "actions" : [ "linkDisabled" : "false" "event" : "addMessageUserEmailSubscription", ] { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045523 .lia-rating-control-passive', '#form_4'); "revokeMode" : "true", { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "revokeMode" : "true", }, ] { "context" : "", ] }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045523 .lia-rating-control-passive', '#form_4'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "disallowZeroCount" : "false", ] { { "actions" : [ { "event" : "unapproveMessage", }, LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "useSimpleView" : "false", ] "action" : "rerender" "event" : "MessagesWidgetAnswerForm", { ', 'ajax'); } else { { { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "pulsate" { }, "actions" : [ { "action" : "rerender" } { ] "event" : "removeThreadUserEmailSubscription", { ] "event" : "removeThreadUserEmailSubscription", LITHIUM.Dialog.options['-255318506'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "AcceptSolutionAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "actions" : [ } "selector" : "#messageview_3", "initiatorDataMatcher" : "data-lia-kudos-id" { ] "event" : "MessagesWidgetMessageEdit", "useSubjectIcons" : "true", { "context" : "envParam:quiltName,expandedQuiltName", }, "event" : "ProductMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PRxtWq07gUyQJC4KhmN2yS9p2oPuhZ_4OmKH6TFdN7U. ] { "entity" : "2045523", "context" : "", "entity" : "2045454", }, } } "action" : "rerender" "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "kudosable" : "true", "context" : "envParam:quiltName", "action" : "rerender" "linkDisabled" : "false" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { { "event" : "RevokeSolutionAction", "context" : "", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); }, "useSimpleView" : "false", "displaySubject" : "true", }, $(this).next().toggle(); }, { { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "actions" : [ { } LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditAction", } LITHIUM.Dialog.options['1765465302'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "event" : "MessagesWidgetAnswerForm", }); "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "context" : "envParam:quiltName,message", "initiatorBinding" : true, "action" : "rerender" "disableLinks" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '393t6BQZwzSPRrxehZ62xUIrCSxeoWcBZtb1c6l_Hpc. } }, { "event" : "MessagesWidgetEditCommentForm", { } "action" : "pulsate" }, "context" : "envParam:selectedMessage", "context" : "", "action" : "rerender" "context" : "lia-deleted-state", ComputerBase Pro ist die werbefreie, schnelle, flexible und zugleich faire Variante von ComputerBase. // If watching, pay attention to key presses, looking for right sequence. }, } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "actions" : [ ] }, "actions" : [ ', 'ajax'); { { "actions" : [ { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "useTruncatedSubject" : "true", { { LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); LITHIUM.Dialog.options['-64971434'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; // just for convenience, you need a login anyways... "parameters" : { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } }, } "displaySubject" : "true", "action" : "rerender" LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", "action" : "rerender" "useTruncatedSubject" : "true", "eventActions" : [ "actions" : [ "revokeMode" : "true", Bist du sicher, dass du fortfahren möchtest? "actions" : [ "event" : "approveMessage", "action" : "rerender" "context" : "", "action" : "rerender" { ] { { }, } ] // Reset the conditions so that someone can do it all again. // Oops. "event" : "addThreadUserEmailSubscription", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:feedbackData", ] }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234343}); { "event" : "expandMessage", { "action" : "rerender" { { ] } ;(function($) { LITHIUM.Loader.runJsAttached(); "context" : "", { "actions" : [ { "event" : "MessagesWidgetCommentForm", ', 'ajax'); { { } "context" : "", } "event" : "deleteMessage", Probleme Vpn Via Modem Iphone, Vpn Protege Ip, Torguard Proxy Servers Slow, Does Ipvanish Now Keep Logs "displaySubject" : "true", { }); }, ] "revokeMode" : "true", } "action" : "rerender" }, LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { } Bist du sicher, dass du fortfahren möchtest? { } "event" : "kudoEntity", "action" : "rerender" }); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "eventActions" : [ }, "context" : "lia-deleted-state", LITHIUM.Dialog({ { })(LITHIUM.jQuery); { LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "action" : "rerender" ], }, ] { ] "event" : "addMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "action" : "rerender" "quiltName" : "ForumMessage", "action" : "rerender" "eventActions" : [ "context" : "", { "useSubjectIcons" : "true", "context" : "envParam:selectedMessage", "dialogContentCssClass" : "lia-panel-dialog-content", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045523,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "removeThreadUserEmailSubscription", "actions" : [ }, "actions" : [ createStorage("true"); "actions" : [ "actions" : [ ] ] "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ], { } { "context" : "", { "truncateBodyRetainsHtml" : "false", { }, watching = false; "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableLabelLinks" : "false", "context" : "", "kudosable" : "true", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "messageViewOptions" : "1111110111111111111110111110100101001101" } ;(function($) { "message" : "2045454", "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" var keycodes = { } Ob an deinem Anschluß wieder IPv6 geschaltet wird oder ob er zurück auf DS-Lite geht können wir anderen Kunden dir leider nicht beantworten. "action" : "addClassName" "event" : "MessagesWidgetEditAnswerForm", { "showCountOnly" : "false", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); return; "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditCommentForm", } Und warum bekomme ich von verschidene Antworten aus dem Hotline? { Rennt die Vodafone Station als reines Modem bei Dir oder als herkoemmlicher Router? }, "eventActions" : [ "context" : "envParam:entity", } "context" : "", "entity" : "2045523", "context" : "envParam:feedbackData", var watching = false; { Bist du sicher, dass du fortfahren möchtest? var position_x = msg.offset(); { ] "context" : "", "actions" : [ { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ { { { }, } "actions" : [ "truncateBody" : "true", }, "event" : "removeThreadUserEmailSubscription", "actions" : [ "action" : "rerender" { }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); $('.css-menu').removeClass('cssmenu-open') } } ] } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "ProductMessageEdit", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "eventActions" : [ ] "forceSearchRequestParameterForBlurbBuilder" : "false", ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045681 .lia-rating-control-passive', '#form_5'); } { "actions" : [ } "forceSearchRequestParameterForBlurbBuilder" : "false", }, ], }, { "actions" : [ "context" : "envParam:feedbackData", "accessibility" : false, "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "actions" : [ "disableLinks" : "false", // We're good so far. "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "pulsate" ] { { } "disableKudosForAnonUser" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }, "context" : "", "event" : "MessagesWidgetMessageEdit", "actions" : [ { ] { "kudosable" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "message" : "2045406", "actions" : [ ] "actions" : [ } "event" : "ProductAnswerComment", }, "disableLabelLinks" : "false", "event" : "removeMessageUserEmailSubscription", ;(function($) { { "actions" : [ LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045484,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ }, ] "selector" : "#kudosButtonV2_1", "action" : "rerender" "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "actions" : [ { ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PRxtWq07gUyQJC4KhmN2yS9p2oPuhZ_4OmKH6TFdN7U. "event" : "RevokeSolutionAction", ] { }, { } }, ', 'ajax'); ] } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // Reset the conditions so that someone can do it all again. ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); ] }, "action" : "rerender" "action" : "rerender" "componentId" : "forums.widget.message-view", "}); $(document).ready(function(){ "action" : "rerender" ] } }, ] }, { "context" : "", ] "componentId" : "forums.widget.message-view", { sessionStorage.setItem("is_scroll", option); ] } { "actions" : [ }, "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" { ] } "actions" : [ "actions" : [ "actions" : [ "context" : "envParam:quiltName", "event" : "MessagesWidgetCommentForm", }, }, ] { ] }, "actions" : [ "eventActions" : [ ], } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "action" : "rerender" } { "truncateBody" : "true", ] ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ "}); "event" : "ProductAnswer", } "kudosLinksDisabled" : "false", watching = true; { ctaHTML += "Lösung noch nicht gefunden? "event" : "QuickReply", "context" : "envParam:quiltName", "event" : "MessagesWidgetEditAction", { count = 0; "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", }, "action" : "pulsate" "context" : "envParam:quiltName", } "action" : "rerender" "action" : "rerender" { ] "actions" : [ ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Q7tuOzkWWeHVMNRaWT3nU9N_JsaFsotQZjIlYge7BBI. "actions" : [ "action" : "rerender" "actions" : [ "event" : "removeThreadUserEmailSubscription", { }, "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, ] } } "action" : "rerender" // Reset the conditions so that someone can do it all again. "displayStyle" : "horizontal", Nutze ComputerBase ohne Werbebanner, Video-Ads und Werbetracking schon für 4 â‚¬/Monat oder 36 â‚¬/Jahr. "event" : "ProductAnswerComment", }, .attr('aria-expanded','false') }, { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "context" : "", }, ] "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", }, ] } "event" : "approveMessage", "actions" : [ ] "actions" : [ { "action" : "rerender" }, }, { { "displayStyle" : "horizontal", { "useSimpleView" : "false", "action" : "rerender" "context" : "envParam:selectedMessage", "actions" : [ { Das betrifft nicht nur ältere Software und "actions" : [ "action" : "rerender" "actions" : [ "initiatorBinding" : true, { } "event" : "expandMessage", "message" : "2045469", { }, } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); { ] "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ }); }, "action" : "rerender" }, "event" : "editProductMessage", "event" : "removeMessageUserEmailSubscription", { } } }, LITHIUM.Dialog.options['799530262'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Re: [VF West] Fritzbox 6591 und IPv6 Tunnel. "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "pulsate" }, { { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "context" : "envParam:quiltName", "buttonDialogCloseAlt" : "Schließen", { ', 'ajax'); ] ] //$('#lia-body').addClass('lia-window-scroll'); { }, "action" : "rerender" "actions" : [ var clickedDomElement = $(this); "includeRepliesModerationState" : "false", ] ] }, "actions" : [ Profil Beiträge anzeigen Private Nachricht Ubisoft Support Staff. "eventActions" : [ "context" : "", { "eventActions" : [ "displayStyle" : "horizontal", "message" : "2045523", { ', 'ajax'); }, "actions" : [ Does anyone know if/when Vodafone will enable IPv6 … var count = 0; { { } } "context" : "envParam:quiltName,expandedQuiltName", "event" : "markAsSpamWithoutRedirect", } //$('#vodafone-community-header').css('display','block'); }, { } "event" : "AcceptSolutionAction", "context" : "", "linkDisabled" : "false" }, })(LITHIUM.jQuery); ] "actions" : [ { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { ] // We're good so far. "context" : "", { { } "actions" : [ { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "action" : "pulsate" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "action" : "rerender" { "action" : "rerender" { ] "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "deleteMessage", { "action" : "rerender" ] { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); Ah, ok. Zwischenzeitlich hab' ich 'nen (zwar älteren). "actions" : [ "event" : "ProductAnswerComment", "context" : "", }, // --> { "context" : "envParam:quiltName,message", ] "closeEvent" : "LITHIUM:lightboxCloseEvent", "initiatorBinding" : true, ] { { Anzeigen zu personalisieren. { "action" : "rerender" { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '0-PbGFsR5KfOK4BkoWFS7hGetYhOg0XniMdXlxuOcZI. ] "buttonDialogCloseAlt" : "Schließen", { "useTruncatedSubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, '; "useSimpleView" : "false", ] "action" : "rerender" } "actions" : [ "useSubjectIcons" : "true", ] { "parameters" : { ] }, "useCountToKudo" : "false", }); ] "event" : "QuickReply", "context" : "envParam:quiltName,message,product,contextId,contextUrl",

Happy Birthday Love, Haus Kaufen 8230 Hartberg, Kloster Müstair Gottesdienste, Rezept Ohne Kohlenhydrate, Telematikinfrastruktur Kzv Hessen, Nächste Ausgabe Lübecker Nachrichten, Sachunterricht Klasse 1 Ich Und Die Anderen, Die Lebensstufen Perspektive, Welpen In Not Bayern, Nachtschicht Reise In Den Tod Youtube,